PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID gw1.05.00.538.1
Common NameOt05g01270, OT_ostta05g01280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 97aa    MW: 11371.1 Da    PI: 10.6513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gw1.05.00.538.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.5e-13144448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     WT eEd     +v+++G++ W+ Ia  +  g+t kq+  rw++yl
  gw1.05.00.538.1  1 WTDEEDAFVRALVREHGPKKWAVIADQLV-GKTQKQVYARWRDYL 44
                     *****************************.*************97 PP

2Myb_DNA-binding29.12.3e-095292345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +W + E+e l++  +  G+  W+  ar ++ gR+++ +k++++
  gw1.05.00.538.1 52 PWAPFEEEHLIKIQEVIGNQ-WAVLARLLP-GRSPNAIKNKFH 92
                     89999*************99.*********.**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.3E-8146IPR001005SANT/Myb domain
SuperFamilySSF466891.84E-23191IPR009057Homeodomain-like
PfamPF002491.1E-12144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-18152IPR009057Homeodomain-like
CDDcd001675.52E-11144No hitNo description
PROSITE profilePS5129423.642148IPR017930Myb domain
SMARTSM007171.7E-44997IPR001005SANT/Myb domain
PROSITE profilePS512949.4934997IPR017930Myb domain
PfamPF002498.1E-85192IPR001005SANT/Myb domain
CDDcd001674.05E-45292No hitNo description
Gene3DG3DSA:1.10.10.603.7E-145394IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
WTDEEDAFVR ALVREHGPKK WAVIADQLVG KTQKQVYARW RDYLQPGLTT RPWAPFEEEH  60
LIKIQEVIGN QWAVLARLLP GRSPNAIKNK FHATRRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-241977103MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-2319761157MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-2319761157MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-241977103C-Myb DNA-Binding Domain
1msf_C8e-241977103C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003079224.15e-66myb family transcription factor-like (ISS)
TrEMBLQ019P36e-66Q019P3_
STRINGQ019P32e-65(Ostreococcus tauri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.22e-26myb domain protein 3r-4
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]